JapanFold

Name: JapanFold
Author: japanfold

by japanfoldversion 1.0.0i★ 0iRuns in the cloud

Registry nameio.github.japanfold/japanfold

How to install

What it does

Fold proteins, co-fold ligands with binding affinity, design binders and embed sequences.

Connects Runs in the cloud
Account or key No key needed
Category Design, images & audio

Install

Pick the AI app you use, then copy the settings.

Passed 3/4 checks · What you ask goes through the maker’s server (api.japanfold.aiand.com) · ✓ Commands checked Nov 13, 2026

First: which AI do you use?

ClaudeWeb · app · phoneChatGPTWebClaude CodeTerminalCursorCode editorVS CodeCode editorOtherOther apps

Pick your app and the steps appear below.

Works with Claude · about 2 min

No key, nothing to install · Set it up once on claude.ai or the desktop app, then use it in chat · free accounts can add 1 · on Team/Enterprise an Owner adds it

Open Claude’s Connectors page
CustomizeConnectors
Done
Click “Add” → “Custom” → “Web” and fill in these 2 fields
Copy each value into the field with the same name in Claude, then click Continue
Name · NameJapanFold
Remote MCP server URL · Addresshttps://api.japanfold.aiand.com/mcp
Click Continue past the sign-in settings Claude detected · under Authentication choose what the maker says (Sign in now, Sign in when needed or No sign in), then click Add
Done
Turn it on in a chat
+ConnectorsJapanFold
Done
Try it
Use JapanFold and tell me what you can do for me, then show me one thing
✓ If Claude says it is using JapanFold or shows a JapanFold tool in the answer, you are connected

Menu names checked against Anthropic’s help page on Nov 11, 2026 · your screen may differ slightly by app version

Works with ChatGPT, depending on your plan

Full MCP: ChatGPT Business, Enterprise or Edu on the web · Pro: connects with read/fetch permissions, so tools that change data may not work · Plus: not confirmed in OpenAI’s docs; if you see an add-custom-MCP option on the Plugins page you can try these steps · web only

Open ChatGPT’s add-MCP page on the web
Plugins+Add custom MCP server
Done
Fill in the name and address
Enter a name, paste the address under Connection, tick the risk warning and click Create as a plugin
Name · NameJapanFold
Connection · Addresshttps://api.japanfold.aiand.com/mcp
Done
Pick JapanFold in a chat
Start a new chat and pick JapanFold from your plugins before typing
Done
Try it
Use JapanFold and tell me what you can do for me, then show me one thing
✓ If ChatGPT says it is using JapanFold or shows a JapanFold tool in the answer, you are connected

Menu names checked against OpenAI’s help page on Nov 11, 2026 · your screen may differ slightly by app version

Works with Claude Code · about 2 min

No key, nothing to install

Open Terminal
Mac: press Command+Space and type Terminal · Windows: open PowerShell
Done

Paste this command and press Enter

claude mcp add --transport http --scope user japanfold https://api.japanfold.aiand.com/mcp

Done

Type /mcp in Claude Code
You should see JapanFold listed as connected
Done
Try it
Use JapanFold and tell me what you can do for me, then show me one thing
✓ If Claude Code says it is using JapanFold or shows a JapanFold tool in the answer, you are connected

Menu names checked against Anthropic’s help page on Nov 11, 2026 · your screen may differ slightly by app version

Works with Cursor · about 2 min

No key, nothing to install

Click this button to open Cursor
Open in Cursor
Cursor asks you to confirm; click Install
Done
Open the AI chat in Cursor in Agent mode
Done
Try it
Use JapanFold and tell me what you can do for me, then show me one thing
✓ If Cursor says it is using JapanFold or shows a JapanFold tool in the answer, you are connected

Menu names checked against Cursor’s help page on Nov 11, 2026 · your screen may differ slightly by app version

Works with VS Code · about 2 min

No key, nothing to install

Click this button to open VS Code
Open in VS Code
VS Code asks you to confirm; click Install
Done
Open the AI chat in VS Code in Agent mode
Done
Try it
Use JapanFold and tell me what you can do for me, then show me one thing
✓ If VS Code says it is using JapanFold or shows a JapanFold tool in the answer, you are connected

Menu names checked against VS Code’s help page on Nov 11, 2026 · your screen may differ slightly by app version

Other apps that use MCP, such as Windsurf, Zed or Gemini CLI, each add servers differently. See how in the app list.

See every app that uses MCP →

Address for apps that connect over the web

Addresshttps://api.japanfold.aiand.com/mcp

JSON settings are under “For developers” below

Stuck? Ask people who use JapanFold💬 Discussion →

For developers: Terminal commands and JSON settings

Over the web

Claude Code

claude mcp add --transport http --scope user japanfold https://api.japanfold.aiand.com/mcp

Cursor (~/.cursor/mcp.json)

{
  "mcpServers": {
    "japanfold": {
      "url": "https://api.japanfold.aiand.com/mcp"
    }
  }
}

VS Code (mcp.json)

{
  "servers": {
    "japanfold": {
      "type": "http",
      "url": "https://api.japanfold.aiand.com/mcp"
    }
  }
}

These settings are generated from the maker’s registry entry. If the README says otherwise, follow the README.

At a glance

GitHub stars i: 0
Downloads per weeki: Not on npm/PyPI
Licence i: No licence stated
Connection: Runs in the cloud
Transport: streamable-http
Latest versioni: 1.0.0
Categoryi: Design, images & audio
Published to registryi: Oct 19, 2026
Code last changedi: Nov 15, 2026
Maker: japanfold
Repo: japanfold/japanfold
Website: japanfold.aiand.com
Registry status: Active

Which apps can use it

Based on how this server connects and on each app’s own docs, checked Nov 10, 2026.

Connect over the internet in

Claude ChatGPT Goose LM Studio Msty Studio Cherry Studio Cursor VS Code + GitHub Copilot Visual Studio Windsurf (Devin Desktop)Zed Kiro Cline Continue JetBrains AI Assistant Claude Code Codex CLI Gemini CLI OpenCode nodecode Warp LibreChat Open WebUI Raycast

All apps, with pros and cons →

What it can do

We have not read this server’s tool list yet; we check endpoints in rotation.

Basic checksi

We check information anyone can see; we have not read the code. Checks that do not apply are left out of the count. · Checked Nov 16, 2026

✓ Pass
Maker matches the repo
The registry name was verified with the GitHub account japanfold, which owns the repo
✓ Pass
Still maintained
Code last changed yesterday
✕ Fail
Has a licence
No licence file found in the repo
✓ Pass
Endpoint responds
Responded in 652 ms (HTTP 200)
– Not applicable
Sign-in with OAuth
No sign-in needed
… Not checked yet
No hidden instructions in tool descriptions
Not checked yet; we read the tool list when we check the endpoint

What we check → · JSON

Makers: ask for a re-check or report wrong info

Discussion

Ask, share a tip or report that it does not work. Sorted by what people marked helpful.

No posts yet. Be the first to ask or share.

Posts here are written by users, not the PopNx team.

User reviews

No reviews yet

Compared with others in Design, images & audioi

More stars than 0% of the other 3098 servers in this category
Published to the registry more recently than 53% of the other 3098 servers in this category
Basic checks equal to or better than 51% of the other 3098 servers in this category

Compared with every active server in this category in the registry. Stars count only when the publisher owns the repo.

Common questions

Is JapanFold safe?

It passed 3 of 4 applicable basic checks. We have not read the code. Before adding a key or token, see what access the server asks for and use a key with only the permissions you need.

What keys or codes does it need?

The registry does not list a required key, though some servers ask you to sign in on first use.

Does it run on my computer or in the cloud?

It runs in the maker’s cloud. Connect over the internet with nothing to install, but what you send passes through the maker’s servers.

Is it still maintained?

The GitHub repo last changed yesterday, and the latest version (1.0.0) reached the registry 28 days ago.

Which apps can use it?

Apps that support MCP, such as Claude Desktop, Claude Code, Cursor and VS Code. It connects by URL, so apps that accept remote MCP servers work too, such as ChatGPT on the web (full MCP on Business and above; Pro read-only).

What can I use instead?

In the same category: Pascal 3D Editor, Figma MCP Server, Remocn: Remotion MCP server, Harness, ChatCut

Similar alternatives

Same category, other makers, commands already checked. Official ones first, then by stars.

Reading a card:↓ Downloads per weeki★ GitHub starsiThree pillars: reviews · checks · usageiUpdated = latest version published to the registryi

Pascal 3D Editor

Create, inspect, validate, and save editable 3D building scenes with Pascal's MCP server.

by pascalorgWidely used↓ 1K/wk★ 25.5K Stars for the whole repoUpdated 3 days ago

Computer or cloud✓ service owner · pascal.app

Install

Figma MCP Server

Figma’s official server gives AI your design data so it can turn designs into code or describe them accurately. Connects to Figma’s cloud.

by figmaWidely used★ 2.2KUpdated 13 months ago

Runs in the cloud✓ service owner · mcp.figma.com

How to connect

Remocn: Remotion MCP server

Hosted MCP for Remotion videos: search Remocn components, read docs, plan a video, preview it.

by RemocnGrowing★ 1.7KUpdated 6 days ago

Runs in the cloud✓ service owner · remocn.dev

How to connect

Harness

Start Claude Code and Codex agents the person can watch, wait for them and read their answers.

by autonomous-aiGrowing↓ 109/wk★ 1.5KUpdated 28 days ago

Runs on your computer✓ harness.autonomous.ai

Install

ChatCut

AI video editor for agents: cut footage, add captions and motion graphics, export editable edits.

by ChatCut-IncGrowing★ 1KUpdated 17 days ago

Runs in the cloud✓ service owner · chatcut.io

How to connect

Pascal 3D Editor — Cloud or install on your computer · No key needed
Figma MCP Server — Runs in the cloud, nothing to install · No key needed · In Claude’s directory
Remocn: Remotion MCP server — Runs in the cloud, nothing to install · No key needed
Harness — Installs on your computer · No key needed
ChatCut — Runs in the cloud, nothing to install · No key needed

README from the maker

Open the README

Copied from the maker’s repo as written. PopNx MCP has not reviewed or endorsed it. HTML, images and scripts are removed. Links lead off this site.

JapanFold skill

Fold proteins, co-fold with ligands (+ binding affinity), design binders, and embed sequences from your AI agent, via the JapanFold API. Get a key at japanfold.aiand.com/account/token and set JAPANFOLD_API_KEY. No local GPU. Runs Boltz-2 / ESMFold-2 / OpenFold3 / OpenBind-0 / RoseTTAFold3 / OpenDDE / Mol-1 for structures, AF2-IG for scoring a binder you already designed, BoltzGen / RFdiffusion3 / PXDesign / RFD4-Proteina for design, and ESMC / SaProt for embeddings, on Tenstorrent.

Agents can call the API directly, no install needed:

export JAPANFOLD_API_KEY=jf_live_...          # from japanfold.aiand.com/account/token

curl -s https://api.japanfold.aiand.com/v1/predictions \ -H "Authorization: Bearer $JAPANFOLD_API_KEY" -H 'Content-Type: application/json' \ -d '{"model":"esmfold2","sequence":"MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ"}'

Base URL https://api.japanfold.aiand.com, key in Authorization: Bearer. GET /v1/models lists the model ids to send (boltz2, esmfold2, openfold3, ...) with their size limits. The agent-readable summary is llms.txt.

It's a single SKILL.md built on the open Agent Skills standard, so it installs into any compatible harness with one command.

Install

Using Claude? Use JapanFold in Claude covers claude.ai, Desktop, mobile, Claude Code, Claude Science and the Claude API, and has a Connect to Claude button that adds the connector in one click.

In Claude Code, install the plugin in one step (Claude Code 2.1.275 or later):

/plugin install japanfold --marketplace japanfold/japanfold

One line installs it everywhere the open standard is supported: Claude Code, Cursor, Codex, Gemini CLI, Cline, Windsurf, Copilot, Amp and the rest:

npx skills add japanfold/japanfold          # this project

npx skills add japanfold/japanfold -g # global: every project / new chat

Target specific agents: -a claude-code, -a cursor, -a codex, -a '*' (all).
Prefer not to use the installer? It is one file. Download it unchanged into your agent's skills directory, for Claude Code: curl -fsSL --create-dirs -o ~/.claude/skills/japanfold/SKILL.md https://japanfold.aiand.com/skill.md. A web-fetch tool returns only a summary of the page, so an agent should use curl too.

Claude Science: add the MCP server under Settings > Connectors > Add connector > Remote, URL https://api.japanfold.aiand.com/mcp, and sign in when the browser opens (no key). For the skill too, Settings > Skills > Add skill > Import from GitHub, japanfold/japanfold. Or skip install entirely: the API is public and self-describing, so just ask: *"use the JapanFold API at api.japanfold.aiand.com to fold …"*.

Use

Once installed, ask your agent in plain language:

*"Fold this sequence with Boltz-2 and report the confidence: MKTAYIAK…"*

*"Design 10 nanobody binders against this target."*

Or invoke it explicitly where supported: /japanfold.

MCP

The API is also a remote MCP server at https://api.japanfold.aiand.com/mcp, listed in the MCP Registry as io.github.japanfold/japanfold. claude.ai, Claude Desktop and ChatGPT add it as a connector and sign in, no key needed. Claude Code: claude mcp add --transport http japanfold https://api.japanfold.aiand.com/mcp --header "Authorization: Bearer $JAPANFOLD_API_KEY".

To publish a new registry version, bump version in server.json and run mcp-publisher login github && mcp-publisher publish.

The API

https://api.japanfold.aiand.com: async (submit → poll → download), a key on every call. Full contract at /v1/openapi.json. See SKILL.md for endpoints, examples, and limits.

Fast mode is off unless the agent sends "params": {"fast": true}. It gives higher throughput and may be slightly less accurate. The workbench turns it on for people clicking through; the API and this skill leave it off so a scripted run gets the accurate path. ESMFold-2 is the exception: an omitted fast means fast for it, and "fast": false runs its normal mode.

JapanFold

What it does

Install

Open Claude’s Connectors page

Click “Add” → “Custom” → “Web” and fill in these 2 fields

Turn it on in a chat

Try it

Open ChatGPT’s add-MCP page on the web

Fill in the name and address

Pick JapanFold in a chat

Try it

Open Terminal

Paste this command and press Enter

Type /mcp in Claude Code

Try it

Click this button to open Cursor

Open the AI chat in Cursor in Agent mode

Try it

Click this button to open VS Code

Open the AI chat in VS Code in Agent mode

Try it

Over the web

At a glance

Which apps can use it

Related guides

What it can do

Basic checksi

Maker matches the repo

Still maintained

Has a licence

Endpoint responds

Sign-in with OAuth

No hidden instructions in tool descriptions

Discussion

User reviews

Compared with others in Design, images & audioi

Common questions

Similar alternatives

Pascal 3D Editor

Figma MCP Server

Remocn: Remotion MCP server

Harness

ChatCut

README from the maker

JapanFold skill

Install

Use

MCP

The API