JapanFold

Name: JapanFold
Author: japanfold

by japanfoldversion 1.0.0i★ –iRuns in the cloud

Registry nameio.github.japanfold/japanfold

Install

Overview

Description from the maker (original English)

Fold proteins, co-fold ligands with binding affinity, design binders and embed sequences.

PopNx MCP’s three pillars

These three are never merged into one score: opinions, measurements and popularity are different things.

User voiceiNo reviews yetReviews open together with accounts in a later step
Our basic checksi1 of 1 passedChecked from public information; code not scanned yet
UsageiNot measured yet★ –

What you can do with it

We have not written a plain-language summary for this one yet. Below are the facts we read from the registry.

Connection: Runs in the cloud
Transport: Streamable HTTP
Category: Design, images & audio

Install

Pick the AI app you use, then copy the settings.

Before you install

Basic checks: 1 of 1 passed
Runs on the maker’s server: what you ask it goes through their server.
The registry lists no key to fill in.

You need

Runs in the cloudNothing to install; it connects over the internet

Which app do you use?

ClaudeClaude CodeCursorVS CodeChatGPT

Pick your app above. We remember it, so next time the button says “Install in …”.

Works in Claude on the web, desktop and mobile:

Open Settings → Connectors
Press Add custom connector
Paste the address below and press Add
If it asks you to sign in, sign in with the maker

https://api.japanfold.aiand.com/mcp

Run this in your terminal

claude mcp add --transport http japanfold https://api.japanfold.aiand.com/mcp

Open in Cursor

Or copy the settings yourself

Paste into .cursor/mcp.json in your project, or ~/.cursor/mcp.json

{
  "mcpServers": {
    "japanfold": {
      "url": "https://api.japanfold.aiand.com/mcp"
    }
  }
}

Your browser asks to open the app, then the app shows the settings and asks you to confirm. Key values are left empty for you to fill in.

Open in VS Code

Or copy the settings yourself

Paste into .vscode/mcp.json in your project

{
  "servers": {
    "japanfold": {
      "type": "http",
      "url": "https://api.japanfold.aiand.com/mcp"
    }
  }
}

Your browser asks to open the app, then the app shows the settings and asks you to confirm. Key values are left empty for you to fill in.

ChatGPT connects only to servers on the internet:

Open ChatGPT on the web → Settings → Connectors (Apps)
Press Create or Add (some plans need Developer mode under Advanced first)
Paste the address below, give it a name and save
If it asks you to sign in, sign in with the maker

https://api.japanfold.aiand.com/mcp

Menu names can differ slightly by plan and over time.

Your choice stays on this device in a cookie; no account needed.

These settings are generated from the maker’s registry entry. If the README says otherwise, follow the README.

What it can do

We have not read this server’s tool list yet; we check endpoints in rotation.

Basic checksi

We check information anyone can see; we have not read the code. Checks that do not apply are left out of the count. · Checked Nov 6, 2026

✓ Pass
Maker matches the repo
The registry name was verified with the GitHub account japanfold, which owns the repo
… Not checked yet
Still maintained
We have not read this repo from GitHub yet
… Not checked yet
Has a licence
We have not read this repo from GitHub yet
… Not checked yet
Endpoint responds
Not checked yet; we check endpoints in rotation
… Not checked yet
Sign-in with OAuth
Not checked yet; we check endpoints in rotation
… Not checked yet
No hidden instructions in tool descriptions
Not checked yet; we read the tool list when we check the endpoint

Compared with others in Design, images & audioi

More stars than 0% of the other 2177 servers in this category
Published to the registry more recently than 63% of the other 2177 servers in this category
Basic checks equal to or better than 100% of the other 2177 servers in this category

Compared with every active server in this category in the registry. Stars count only when the publisher owns the repo.

Common questions

Is JapanFold safe?

It passed 1 of 1 applicable basic checks. We have not read the code. Before adding a key or token, see what access the server asks for and use a key with only the permissions you need.

What keys or codes does it need?

The registry does not list a required key, though some servers ask you to sign in on first use.

Does it run on my computer or in the cloud?

It runs in the maker’s cloud. Connect over the internet with nothing to install, but what you send passes through the maker’s servers.

Is it still maintained?

The GitHub repo last changed –, and the latest version (1.0.0) reached the registry 18 days ago.

Which apps can use it?

Apps that support MCP, such as Claude Desktop, Claude Code, Cursor and VS Code. It connects by URL, so apps that accept remote MCP servers work too, such as ChatGPT in developer mode.

What can I use instead?

In the same category: Figma Context MCP, Claude Real Video, Figma MCP Server

Alternatives

Servers in the same category from other makers, sorted by stars.

Reading a card:★ GitHub starsiThree pillars: reviews · checks · usageiUpdated = latest version published to the registryi

Figma Context MCP

by GLips

Give your coding agent access to your Figma data. Implement designs in any framework in one-shot.

Runs on your computer★ 16,165MITUpdated 5 months ago

Install

Claude Real Video

by HUANGCHIHHUNGLeo

Let any LLM watch a video locally — and search everything it has ever watched.

Runs on your computer★ 2,284MITUpdated 2 months ago

Install

Figma MCP Server

by figma

Figma’s official server gives AI your design data so it can turn designs into code or describe them accurately. Connects to Figma’s cloud.

Runs in the cloud★ 2,152Updated 13 months ago

Install

README from the maker

Open the README

Copied from the maker’s repo as written. PopNx MCP has not reviewed or endorsed it. HTML, images and scripts are removed. Links lead off this site.

JapanFold skill

Fold proteins, co-fold with ligands (+ binding affinity), design binders, and embed sequences from your AI agent, via the JapanFold API. Get a key at japanfold.aiand.com/account/token and set JAPANFOLD_API_KEY. No local GPU. Runs Boltz-2 / ESMFold-2 / OpenFold3 / OpenBind-0 / RoseTTAFold3 / OpenDDE / Mol-1 for structures, AF2-IG for scoring a binder you already designed, BoltzGen / RFdiffusion3 / PXDesign / RFD4-Proteina for design, and ESMC / SaProt for embeddings, on Tenstorrent.

Agents can call the API directly, no install needed:

export JAPANFOLD_API_KEY=jf_live_...          # from japanfold.aiand.com/account/token

curl -s https://api.japanfold.aiand.com/v1/predictions \ -H "Authorization: Bearer $JAPANFOLD_API_KEY" -H 'Content-Type: application/json' \ -d '{"model":"esmfold2","sequence":"MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ"}'

Base URL https://api.japanfold.aiand.com, key in Authorization: Bearer. GET /v1/models lists the model ids to send (boltz2, esmfold2, openfold3, ...) with their size limits. The agent-readable summary is llms.txt.

It's a single SKILL.md built on the open Agent Skills standard, so it installs into any compatible harness with one command.

Install

One line installs it everywhere the open standard is supported: Claude Code, Cursor, Codex, Gemini CLI, Cline, Windsurf, Copilot, Amp and the rest:

npx skills add japanfold/japanfold          # this project

npx skills add japanfold/japanfold -g # global: every project / new chat

Target specific agents: -a claude-code, -a cursor, -a codex, -a '*' (all).
Prefer not to use the installer? It is one file. Download it unchanged into your agent's skills directory, for Claude Code: curl -fsSL --create-dirs -o ~/.claude/skills/japanfold/SKILL.md https://japanfold.aiand.com/skill.md. A web-fetch tool returns only a summary of the page, so an agent should use curl too.

Claude Science manages skills in-app (no installer): Customize → Skills, add from this repo (or paste SKILL.md) and publish it. Or skip install entirely: the API is public and self-describing, so just ask: *"use the JapanFold API at api.japanfold.aiand.com to fold …"*.

Use

Once installed, ask your agent in plain language:

*"Fold this sequence with Boltz-2 and report the confidence: MKTAYIAK…"*

*"Design 10 nanobody binders against this target."*

Or invoke it explicitly where supported: /japanfold.

MCP

The API is also a remote MCP server at https://api.japanfold.aiand.com/mcp, listed in the MCP Registry as io.github.japanfold/japanfold. claude.ai, Claude Desktop and ChatGPT add it as a connector and sign in, no key needed. Claude Code: claude mcp add --transport http japanfold https://api.japanfold.aiand.com/mcp --header "Authorization: Bearer $JAPANFOLD_API_KEY".

To publish a new registry version, bump version in server.json and run mcp-publisher login github && mcp-publisher publish.

The API

https://api.japanfold.aiand.com: async (submit → poll → download), a key on every call. Full contract at /v1/openapi.json. See SKILL.md for endpoints, examples, and limits.

Fast mode is off unless the agent sends "params": {"fast": true}. It gives higher throughput and may be slightly less accurate. The workbench turns it on for people clicking through; the API and this skill leave it off so a scripted run gets the accurate path. ESMFold-2 is the exception: an omitted fast means fast for it, and "fast": false runs its normal mode.

JapanFold

Overview

PopNx MCP’s three pillars

What you can do with it

Install

Before you install

What it can do

Basic checksi

Maker matches the repo

Still maintained

Has a licence

Endpoint responds

Sign-in with OAuth

No hidden instructions in tool descriptions

Compared with others in Design, images & audioi

Common questions

Alternatives

Figma Context MCP

Claude Real Video

Figma MCP Server

README from the maker

JapanFold skill

Install

Use

MCP

The API